PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca7416.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 155aa    MW: 18096.9 Da    PI: 10.0668
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca7416.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM144.94.3e-45101381129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtdeel ++yLk+kv gk+l   ++++e+d++++ Pw+Lp k ++k+++ +wyf ++r+k+y+++ r++ra ++g+Wk+tg+d++v   k++
  Dca7416.1  10 LPPGFRFHPTDEELFMFYLKRKVLGKSLGP-QMMTEIDVFHHAPWELPsKaCLKTKDLNWYFMCPRNKRYPSSGRSSRASEHGFWKSTGTDRTVNY-KNR 107
                79*************************988.88**************96347778888*************************************9.899 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                 vg  ktL+f++g+apkge+tdWvmheyrle
  Dca7416.1 108 PVGKIKTLIFHRGKAPKGERTDWVMHEYRLE 138
                9****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-534155IPR003441NAC domain
PROSITE profilePS5100550.34810155IPR003441NAC domain
PfamPF023653.5E-2411137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MDALLGSKVL PPGFRFHPTD EELFMFYLKR KVLGKSLGPQ MMTEIDVFHH APWELPSKAC  60
LKTKDLNWYF MCPRNKRYPS SGRSSRASEH GFWKSTGTDR TVNYKNRPVG KIKTLIFHRG  120
KAPKGERTDW VMHEYRLEDR MLLEQGVAQD SYVIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-451015517160NO APICAL MERISTEM PROTEIN
1ut4_B5e-451015517160NO APICAL MERISTEM PROTEIN
1ut7_A5e-451015517160NO APICAL MERISTEM PROTEIN
1ut7_B5e-451015517160NO APICAL MERISTEM PROTEIN
3swm_A5e-451015520163NAC domain-containing protein 19
3swm_B5e-451015520163NAC domain-containing protein 19
3swm_C5e-451015520163NAC domain-containing protein 19
3swm_D5e-451015520163NAC domain-containing protein 19
3swp_A5e-451015520163NAC domain-containing protein 19
3swp_B5e-451015520163NAC domain-containing protein 19
3swp_C5e-451015520163NAC domain-containing protein 19
3swp_D5e-451015520163NAC domain-containing protein 19
4dul_A5e-451015517160NAC domain-containing protein 19
4dul_B5e-451015517160NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010674451.12e-88PREDICTED: NAC domain-containing protein 78-like
SwissprotQ9FY826e-56NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A0J8FE272e-88A0A0J8FE27_BETVU; Uncharacterized protein
TrEMBLA0A0K9RG693e-88A0A0K9RG69_SPIOL; Uncharacterized protein
STRINGVIT_04s0044g01220.t017e-64(Vitis vinifera)
STRINGPOPTR_0005s06040.13e-64(Populus trichocarpa)
STRINGBra024263.1-P2e-64(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.15e-64NAC domain containing protein 103